PPIRE16558
Target Protein Information
| Protein_Name | Complement C1q subcomponent subunit A |
|---|---|
| Protein_Sequence | MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA |
| Organism_Source | Homo sapiens |
| Functional_Classification | complement components |
| Cellular_Localization | Extracellular |
| Gene_Names | C1QA |
| UniProt_ID | P02745 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | d8-22 |
|---|---|
| Peptide_Sequence | PAICQRAEIEACILL |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)O)[C@@H](C)CC)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1642.99 |
|---|---|
| Aliphatic_Index | 150.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | -1.12242 |
| Isoelectric_Point | 4.25807 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 22 |
| Number_of_Hydrogen_Bond_Donors | 24 |
| Topological_Polar_Surface_Area | 636.32000 |
| X_logP_energy | -3.98163 |
Interaction Information
| Affinity | KD=5.43 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A novel peptide inhibitor of classical and lectin complement activation including ABO incompatibility |
| Release_Year | 2012 |
| PMID | 22906481 |
| DOI | 10.1016/j.molimm.2012.07.012 |