PPIRE16564
Target Protein Information
| Protein_Name | Ig gamma-2 chain C region |
|---|---|
| Protein_Sequence | SARTTAPSVFPLAASCVDTSGSMMTLGCLVKGYFPEPVTVKWNSGALTSGVHTFPAVLQSGLYSLTSMVTVPSSQKATCNVAHPASSTKVDKTVEPIRTPZPBPCTCPKCPPPENLGGPSVFIFPPKPKDTLMISLTPRVTCVVVDVSQDEPEVQFTWFVDNKPVGNAETKPRVEQYNTTFRVESVLPIQHQDWLRGKEFKCKVYNKALPAPIEKTISKTKGAPRMPDVYTLPPSRDELSKSKVSVTCLIINFFPADIHVEWASNRVPVSEKEYKNTPPIEDADGSYFLYSKLTVDKSAWDQGTVYTCSVMHEALHNHVTQKAISRSPG |
| Organism_Source | Cavia porcellus |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P01862 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CCK-10 |
|---|---|
| Peptide_Sequence | DRDYMGWMDF |
| Peptide_Length | 10 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CC(=O)O)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | Y4=sulfotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1335.47 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.30000 |
| Average_Rotatable_Bonds | 4.10000 |
| Charge_at_pH_7 | -2.00153 |
| Isoelectric_Point | 3.82610 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 18 |
| Number_of_Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 535.04000 |
| X_logP_energy | -2.49853 |
Interaction Information
| Affinity | IC50=1.7 pM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Induction and Detection of Anti-Peptide Antibody Specificity Is Critically Affected by the Mode of Hapten Presentation |
| Release_Year | 1992 |
| PMID | 1381185 |
| DOI | 10.1515/bchm3.1992.373.1.315 |