PPIRE16569
Target Protein Information
| Protein_Name | Ig gamma-2 chain C region |
|---|---|
| Protein_Sequence | SARTTAPSVFPLAASCVDTSGSMMTLGCLVKGYFPEPVTVKWNSGALTSGVHTFPAVLQSGLYSLTSMVTVPSSQKATCNVAHPASSTKVDKTVEPIRTPZPBPCTCPKCPPPENLGGPSVFIFPPKPKDTLMISLTPRVTCVVVDVSQDEPEVQFTWFVDNKPVGNAETKPRVEQYNTTFRVESVLPIQHQDWLRGKEFKCKVYNKALPAPIEKTISKTKGAPRMPDVYTLPPSRDELSKSKVSVTCLIINFFPADIHVEWASNRVPVSEKEYKNTPPIEDADGSYFLYSKLTVDKSAWDQGTVYTCSVMHEALHNHVTQKAISRSPG |
| Organism_Source | Cavia porcellus |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P01862 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CCK-12 |
|---|---|
| Peptide_Sequence | ISDRDYMGWMDF |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | Y6=sulfotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1535.71 |
|---|---|
| Aliphatic_Index | 32.50000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | -2.00153 |
| Isoelectric_Point | 3.82610 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 613.47000 |
| X_logP_energy | -3.49053 |
Interaction Information
| Affinity | IC50=1.8 pM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Induction and Detection of Anti-Peptide Antibody Specificity Is Critically Affected by the Mode of Hapten Presentation |
| Release_Year | 1992 |
| PMID | 1381185 |
| DOI | 10.1515/bchm3.1992.373.1.315 |