PPIRE16757
Target Protein Information
| Protein_Name | Disabled homolog 1 |
|---|---|
| Protein_Sequence | MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPNSQPLEDFESRFAAATPNRNLSMDFDELLEATKVSAVTQLELFGDMSTPPDITSPPTPATPGDAFLPSSSQTLPGSADVFGSMSFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQIAMGAQPPVAQVIPGAQPIAWGQPGLFPATQQAWPTVAGQFPPAAFMPTQTVMPLAAAMFQGPLTPLATVPGTNDSARSSPQSDKPRQKMGKESFKDFQMVQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHVSDPTADDIFEEGFESPSKSEEQEAPDGSQASSTSDPFGEPSGEPSGDNISPQDGS |
| Organism_Source | Mus musculus |
| Functional_Classification | phosphotyrosine binding domains |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Dab1 |
| UniProt_ID | P97318 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ApoER2 peptide |
|---|---|
| Peptide_Sequence | TKSMNFDNPVYRKT |
| Peptide_Length | 14 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)[C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)O)[C@@H](C)O)C(C)C |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1700.93 |
|---|---|
| Aliphatic_Index | 20.71429 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.92857 |
| Charge_at_pH_7 | 1.99699 |
| Isoelectric_Point | 10.24366 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 26 |
| Number_of_Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 751.17000 |
| X_logP_energy | -8.69233 |
Interaction Information
| Affinity | KD=3 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | 1NU2 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The Dual-Function Disabled-1 PTB Domain Exhibits Site Independence in Binding Phosphoinositide and Peptide Ligands |
| Release_Year | 2004 |
| PMID | 15323557 |
| DOI | 10.1021/bi049092l |