PPIRE16768
Target Protein Information
| Protein_Name | Periplasmic oligopeptide-binding protein OppA |
|---|---|
| Protein_Sequence | MQHKLLFSAIALALSYSAQAVIVPEGTQLDEKQHIVINNGAEPQSFDPHKTEGVPESNVAYQLLEGLVTSDSEGKLQPGAAESWENTPDFKTWTFHLRKDAKWSNGDPVTAHDFVFAWRRLVDPATAAPYASYLSYLQVENAQDIIDGKKKPAELGVEXKDDYTFVVHTTNPVPYTVSXXTHQSLLPLPXKVVEKLGDAWVKKENYVGNGAYKLANHIINEKIEFERNPLYWNDKETVINSATFLAIENPSTDVARYRAGDLDMTSYGLPPEQFAKLQKELPGEVYVTRTLGTYSYELNNKKAPFDNVNIRKALNLSLDRNVITDKVLGQGQTPTYVFTPTYIEEGHLIQQPAYSKEPMAQRNEEAIKLLEEAGYSKANPLKFSILYNTNENHKKVAIAAASMWKANTKGLIDVKLENQEWKTYIDSRRAGRYDVARAGWNADYNQATTFGNYFLSNSSNNTAKYANPEYDKAMAESYAATDAEGRAKAYAKAEEILGKDYGIVPIFNYVNPRLVKPYVKGYSGKDPQDHIYLRNLYIIKH |
| Organism_Source | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Functional_Classification | ATP-binding cassette (ABC) transporter substrate-binding protein (SBP) |
| Cellular_Localization | Extracellular |
| Gene_Names | oppA |
| UniProt_ID | P71370 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P4GIINTL |
|---|---|
| Peptide_Sequence | GIINTL |
| Peptide_Length | 6 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CN)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)O)[C@@H](C)O)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 629.75 |
|---|---|
| Aliphatic_Index | 195.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.33333 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 9 |
| Number_of_Hydrogen_Bond_Donors | 9 |
| Topological_Polar_Surface_Area | 272.14000 |
| X_logP_energy | -2.15180 |
Interaction Information
| Affinity | KD=172 nM |
|---|---|
| Affinity_Assay | intrinsic tryptophan fluorescence quenching |
| PDB_ID | None |
| Type | Substrate |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Multifunctional substrate binding of OppA from nontypeable Haemophilus influenzae has ligandpecific sites to accommodate peptides and heme in the binding pocket |
| Release_Year | 2018 |
| PMID | 30455346 |
| DOI | 10.1074/jbc.RA118.004479 |