PPIRE16791
Target Protein Information
| Protein_Name | Fibroblast growth factor 2 |
|---|---|
| Protein_Sequence | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Organism_Source | Homo sapiens |
| Functional_Classification | fibroblast growth factors |
| Cellular_Localization | Extracellular |
| Gene_Names | FGF2 |
| UniProt_ID | P09038 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P65e97 |
|---|---|
| Peptide_Sequence | AECKYQFQAWGECDLNTALKTRTGSLKRALHNA |
| Peptide_Length | 33 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)N)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3725.21 |
|---|---|
| Aliphatic_Index | 62.42424 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.78788 |
| Charge_at_pH_7 | 1.96720 |
| Isoelectric_Point | 8.78965 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 54 |
| Number_of_Hydrogen_Bond_Donors | 59 |
| Topological_Polar_Surface_Area | 1626.26000 |
| X_logP_energy | -18.26666 |
Interaction Information
| Affinity | EC50=3.95 mM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Proliferation and migration activities of fibroblast growth factor-2 in endothelial cells are modulated by its direct interaction with heparin affin regulatory peptide |
| Release_Year | 2014 |
| PMID | 25315978 |
| DOI | 10.1016/j.biochi.2014.10.002 |