PPIRE16807
Target Protein Information
| Protein_Name | Protein kinase C alpha type |
|---|---|
| Protein_Sequence | MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine threonine kinases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PRKCA |
| UniProt_ID | P17252 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PKC3 |
|---|---|
| Peptide_Sequence | SSWYLTGSQYPDRRTSISR |
| Peptide_Length | 19 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CO)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | biotinylated |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2260.45 |
|---|---|
| Aliphatic_Index | 41.05263 |
| Aromaticity | 0.15789 |
| Average_Rotatable_Bonds | 3.68421 |
| Charge_at_pH_7 | 1.99672 |
| Isoelectric_Point | 10.11505 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 34 |
| Number_of_Hydrogen_Bond_Donors | 40 |
| Topological_Polar_Surface_Area | 1042.28000 |
| X_logP_energy | -13.77179 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification and characterization of peptide probes directed against PKCalpha conformations |
| Release_Year | 2003 |
| PMID | 12662360 |
| DOI | 10.1034/j.1399-3011.2003.00056.x |