PPIRE16842
Target Protein Information
| Protein_Name | Immunoglobulin kappa constant |
|---|---|
| Protein_Sequence | RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC |
| Organism_Source | Mus musculus |
| Functional_Classification | Fab fragments |
| Cellular_Localization | Extracellular |
| Gene_Names | Igkc |
| UniProt_ID | P01837 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | B1 |
|---|---|
| Peptide_Sequence | WIPNSEFEHERT |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1544.64 |
|---|---|
| Aliphatic_Index | 32.50000 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 3.91667 |
| Charge_at_pH_7 | -1.90578 |
| Isoelectric_Point | 4.47387 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 676.45000 |
| X_logP_energy | -5.67793 |
Interaction Information
| Affinity | KD=6.1 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Development of phage biopanning strategies to identify affinity peptide ligands for kappa light chain Fab fragments |
| Release_Year | 2019 |
| PMID | 31301216 |
| DOI | 10.1002/btpr.2884 |