PPIRE16893
Target Protein Information
| Protein_Name | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 |
|---|---|
| Protein_Sequence | MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK |
| Organism_Source | Homo sapiens |
| Functional_Classification | peptidyl prolyl cis trans isomerases |
| Cellular_Localization | Mitochondria |
| Gene_Names | PIN4 |
| UniProt_ID | Q9Y237 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SSFPPLLD |
|---|---|
| Peptide_Sequence | SSFPPLLD |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 874.99 |
|---|---|
| Aliphatic_Index | 97.50000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 2.87500 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 327.20000 |
| X_logP_energy | -2.40150 |
Interaction Information
| Affinity | KD=1.6 mM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification and characterization of peptides that bind the PPIase domain of Parvulin17 |
| Release_Year | 2013 |
| PMID | 23596087 |
| DOI | 10.1002/psc.2510 |