PPIRE16958
Target Protein Information
| Protein_Name | Myoglobin |
|---|---|
| Protein_Sequence | MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG |
| Organism_Source | Homo sapiens |
| Functional_Classification | oxygeninding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MB |
| UniProt_ID | P02144 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 3R10 |
|---|---|
| Peptide_Sequence | CVPRLSAPC |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](N)CS)C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | Side chain-side chain cyclization; C1<-->C9; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | biotin |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 945.16 |
|---|---|
| Aliphatic_Index | 86.66667 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.77778 |
| Charge_at_pH_7 | 0.87403 |
| Isoelectric_Point | 8.23141 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 14 |
| Number_of_Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 360.67000 |
| X_logP_energy | -3.87373 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification of peptides that selectively bind to myoglobin by biopanning of phage displayed-peptide library |
| Release_Year | 2014 |
| PMID | 25078431 |
| DOI | 10.1016/j.jbiotec.2014.07.435 |