PPIRE16980
Target Protein Information
| Protein_Name | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|---|
| Protein_Sequence | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
| Organism_Source | Homo sapiens |
| Functional_Classification | peptidyl prolyl cis trans isomerases |
| Cellular_Localization | Nucleus |
| Gene_Names | PIN1 |
| UniProt_ID | Q13526 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | GGGApSPF peptide |
|---|---|
| Peptide_Sequence | GGGApSPF |
| Peptide_Length | 8 |
| Peptide_SMILES | C[C@H](NC(=O)CNC(=O)CNC(=O)CN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | RhodamineB |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 688.74 |
|---|---|
| Aliphatic_Index | 12.50000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 2.00000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 10 |
| Number_of_Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 269.67000 |
| X_logP_energy | -4.04660 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Transient Domain Interactions Enhance the Affinity of the Mitotic Regulator Pin1 toward Phosphorylated Peptide Ligands |
| Release_Year | 2013 |
| PMID | 23972472 |
| DOI | 10.1016/j.str.2013.07.016 |