PPIRE17026
Target Protein Information
| Protein_Name | ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 |
|---|---|
| Protein_Sequence | MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL |
| Organism_Source | Homo sapiens |
| Functional_Classification | GPI anchored membrane receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | BST1 |
| UniProt_ID | Q10588 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SNP-1 |
|---|---|
| Peptide_Sequence | HSQISGKYQRYLKDA |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)Cc1c[nH]cn1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1794.00 |
|---|---|
| Aliphatic_Index | 58.66667 |
| Aromaticity | 0.13333 |
| Average_Rotatable_Bonds | 4.06667 |
| Charge_at_pH_7 | 2.08705 |
| Isoelectric_Point | 9.92876 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 27 |
| Number_of_Hydrogen_Bond_Donors | 29 |
| Topological_Polar_Surface_Area | 817.74000 |
| X_logP_energy | -8.69703 |
Interaction Information
| Affinity | KD=736 nM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Weak interaction between inhibition peptides and a soluble receptor of fusion protein in the liquid phase |
| Release_Year | 2006 |
| PMID | 16966807 |
| DOI | 10.2116/analsci.22.1185 |