PPIRE17115
Target Protein Information
| Protein_Name | Microtubule-associated protein tau |
|---|---|
| Protein_Sequence | MAEPRQEFDVMEDHAQGDYTLQDQEGDMDPGLKESPLQTPADDGSEEPGSETSDAKSTPTAEDATAPLVDEGAPGEQAAAQAPAEIPEGTAAEEAGIGDTSNLEDQAAGHVTQARMVSKGKDGTGPDDKKTKGADGKPGTKIATPRGAAPPGQKGQANATRIPAKTTPTPKTSPATMQVQKKPPPAGAKSERGESGKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSAAKSRLQAAPGPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL |
| Organism_Source | Bos taurus |
| Functional_Classification | microtubule associated proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAPT |
| UniProt_ID | P29172 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | beta(422-434) |
|---|---|
| Peptide_Sequence | YQQYQDATADEQG |
| Peptide_Length | 13 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)O)[C@@H](C)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1516.50 |
|---|---|
| Aliphatic_Index | 15.38462 |
| Aromaticity | 0.15385 |
| Average_Rotatable_Bonds | 3.76923 |
| Charge_at_pH_7 | -3.00105 |
| Isoelectric_Point | 3.38003 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 24 |
| Topological_Polar_Surface_Area | 757.47000 |
| X_logP_energy | -9.95930 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Differential interaction of synthetic peptides from the carboxyl-terminal regulatory domain of tubulin with microtubule-associated proteins |
| Release_Year | 1988 |
| PMID | 3416830 |
| DOI | 10.1002/j.1460-2075.1988.tb03033.x |