PPIRE17124
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MNIRNKIENSKTLLFTSLVAVALLGATQPVSAETYTSRNFDWPEDDWSGDGLSKYDRSGVGLSQYGWSKYGWSSDKEEWPEDWPEDDWSSDKKDETEDKTRPPYGEALGTGYEKRDDWGGPGTVATDPYTPPYGGALGTGYEKRDDWGGPGTVATDPYTPPYGGALGTGYEKRDDWRGPGHIPKPENEQSPNPSHIPEPPQIEWPQWNGFDGLSSGPSDWGQSEDTPRFPSEPRVTEKPQHTPQKNPQESDFDRGFSAGLKAKNSGRGIDFEGFQYGGWSDEYKKGYMQAFGTPYTPSAT |
| Organism_Source | Streptococcus pyogenes |
| Functional_Classification | Bacterial toxins immune evasion factors |
| Cellular_Localization | Extracellular |
| Gene_Names | sic |
| UniProt_ID | F2WZ73 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | hBD-2 |
|---|---|
| Peptide_Sequence | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Peptide_Length | 41 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CN)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CS)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)CC)C(C)C)[C@@H](C)CC)[C@@H](C)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 4334.24 |
|---|---|
| Aliphatic_Index | 64.14634 |
| Aromaticity | 0.04878 |
| Average_Rotatable_Bonds | 3.34146 |
| Charge_at_pH_7 | 5.71516 |
| Isoelectric_Point | 9.18771 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 63 |
| Number_of_Hydrogen_Bond_Donors | 62 |
| Topological_Polar_Surface_Area | 1647.49000 |
| X_logP_energy | -17.54586 |
Interaction Information
| Affinity | KD=23.95 mM |
|---|---|
| Affinity_Assay | Farr precipitation assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Streptococcal DRS (distantly related to SIC) and SIC inhibit antimicrobial peptides components of mucosal innate immunity: a comparison of their activities |
| Release_Year | 2007 |
| PMID | 17303463 |
| DOI | 10.1016/j.micinf.2006.12.006 |