PPIRE17132
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | XSARNPTIYPLTLPRALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGGYTMSSQLTLPAVECPEGESVKCSVQHDSNAVQELDVKCSGPPPPCPPCPPSCHPSLSLQRPALEDLLLGSDASLTCTLNGLRNPEGAVFTWEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESDTLTGTIAKITVNTFPPQVHLLPPPSEELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAELWKQGDQYSCMVGHEALPMNFTQKTIDRLSGKPTNVSVSVIMSEGDGICY |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | Igha |
| UniProt_ID | A0A075B6A3 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p22 |
|---|---|
| Peptide_Sequence | KRHFLSQRQ |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1199.38 |
|---|---|
| Aliphatic_Index | 43.33333 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 4.66667 |
| Charge_at_pH_7 | 3.08859 |
| Isoelectric_Point | 12.51648 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 17 |
| Number_of_Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 581.03000 |
| X_logP_energy | -6.28986 |
Interaction Information
| Affinity | IC50=70 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Toward a Better Understanding of the Basis of the Molecular Mimicry of Polysaccharide Antigens by Peptides: THE EXAMPLE OF SHIGELLA FLEXNERI 5A |
| Release_Year | 2006 |
| PMID | 16251186 |
| DOI | 10.1074/jbc.M510172200 |