PPIRE17221
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MRVRGPQAILILLSGALALTGTQAGPHSLSYFYTAVSRPDRGDSCFFIVGYVDDTRFVRFDSDAPNAKMEPRAQWIQQEGQEYWDRETQISKDNAQINRVNLNTLRGYYNQSEAGSHTLQRMYGCYLGPDGLLLRGYDQDAYDGADYIALNEDLRSWTAADMAAQISKRKREAADEAEQMRSYLQGRCVEWLQKYLEMGKDTLQRAEPPKTHVTRHSSSDLGVTLRCWALGFYPKEISLSWQREGQDQSQDMELVETRPSGDGTFQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWDPAQPPVPMVGIIVGLVLVLVAGAMAAGVVIWRKKRSGEKGGSYTQAAGSDSAQGSDVSLTQDPRV |
| Organism_Source | Sus scrofa |
| Functional_Classification | MHC class1 molecules |
| Cellular_Localization | Plasma membrane |
| Gene_Names | SLA2 |
| UniProt_ID | A0A2Z1I809 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | NTYLSGIAQY |
|---|---|
| Peptide_Sequence | NTYLSGIAQY |
| Peptide_Length | 10 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(N)=O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1129.23 |
|---|---|
| Aliphatic_Index | 88.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.40000 |
| Charge_at_pH_7 | -0.00372 |
| Isoelectric_Point | 6.08660 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 17 |
| Number_of_Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 492.32000 |
| X_logP_energy | -5.08440 |
Interaction Information
| Affinity | KD=22 nM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification of peptides from foot-and-mouth disease virus structural proteins bound by class I swine leukocyte antigen (SLA) alleles SLA-1*0401 and SLA-2*0401 |
| Release_Year | 2012 |
| PMID | 22984928 |
| DOI | 10.1111/j.1365-2052.2012.02400.x |