PPIRE17227
Target Protein Information
| Protein_Name | Protein B14 homolog |
|---|---|
| Protein_Sequence | MSSSNYVYRNNFSDDDDITTAISDYLFWSSLAFSSREVAGNVFLVFESFKKDASLVFGNDLTAFVKNMFLDSKIGFEQSKIMINSMLKKENHIRESCAVIGILARAAEYWGGESSPTCSSMKVLVLLRDLVSDNDISLVKSALIIRLKRLNEKSIHLQV |
| Organism_Source | Sheeppox virus (strain InS-1) |
| Functional_Classification | Viral modulators of host response kelch like virulence factors |
| Cellular_Localization | Mitochondria |
| Gene_Names | None |
| UniProt_ID | P18387 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Bok_BH3 |
|---|---|
| Peptide_Sequence | VPGRLAEVCAVLLRLGDELEMIRPSV |
| Peptide_Length | 26 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2836.40 |
|---|---|
| Aliphatic_Index | 142.30769 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.57692 |
| Charge_at_pH_7 | -1.05823 |
| Isoelectric_Point | 4.58756 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 37 |
| Number_of_Hydrogen_Bond_Donors | 40 |
| Topological_Polar_Surface_Area | 1128.37000 |
| X_logP_energy | -7.73199 |
Interaction Information
| Affinity | KD=7.58 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structures of the sheeppoxvirus encoded inhibitor of apoptosis SPPV14 bound to Hrk and Bax BH3 peptides |
| Release_Year | 2020 |
| PMID | 32390192 |
| DOI | 10.1002/1873-3468.13807 |