PPIRE17311
Target Protein Information
| Protein_Name | H-2 class II histocompatibility antigen A-Q beta chain |
|---|---|
| Protein_Sequence | MALQIPSLLLSAAVVVLMVLSSPRTEGGNSERHFVAQLKGECYFTNGTQRIRSVNRYIYNREEWVRFDSDVGEYRAVTELGRPDAEYWNSQPEILERTRAEVDTVCRHNYEGVETHTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQSESARSKMLSGIGGCVLGVIFLGLGLFIRHRSQKGPRGPPPAGLLQ |
| Organism_Source | Mus musculus |
| Functional_Classification | MHC class 2 |
| Cellular_Localization | Plasma membrane |
| Gene_Names | H2-Ab1 |
| UniProt_ID | P06342 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ROIV peptide |
|---|---|
| Peptide_Sequence | YAHAAHAAHAAHAAHAA |
| Peptide_Length | 17 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1648.76 |
|---|---|
| Aliphatic_Index | 64.70588 |
| Aromaticity | 0.05882 |
| Average_Rotatable_Bonds | 2.64706 |
| Charge_at_pH_7 | 0.45168 |
| Isoelectric_Point | 7.92506 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 24 |
| Topological_Polar_Surface_Area | 692.55000 |
| X_logP_energy | -7.84870 |
Interaction Information
| Affinity | IC50=28 nM |
|---|---|
| Affinity_Assay | Competition binding assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Mapping Immune Responses to mRBP-3 1-16 Peptide with Altered Peptide Ligands |
| Release_Year | 2006 |
| PMID | 16639012 |
| DOI | 10.1167/iovs.05-0984 |