PPIRE17357
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MRYLIATAVLVAVVLVGWPAAGAPPSCAGLGGTVQAGQICHVHASGPKYMLDMTFPVDYPDQQALTDYITQNRDGFVNVAQGSPLRDQPYQMDATSEQHSSGQPPQATRSVVLKFFQDLGGAHPSTWYKAFNYNLATSQPITFDTLFVPGTTPLDSIYPIVQRELARQTGFGAAILPSTGLDPAHYQNFAITDDSLIFYFAQGELLPSFVGACQAQVPRSAIPPLAI |
| Organism_Source | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Functional_Classification | None |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | O53283 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | M2 |
|---|---|
| Peptide_Sequence | SDSMLSWGGGS |
| Peptide_Length | 11 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1083.14 |
|---|---|
| Aliphatic_Index | 35.45455 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.09091 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 18 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 488.33000 |
| X_logP_energy | -7.89240 |
Interaction Information
| Affinity | KD=4.9 nM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Selection and application of peptide mimotopes of MPT64 protein in Mycobacterium tuberculosis |
| Release_Year | 2011 |
| PMID | 20930053 |
| DOI | 10.1099/jmm.0.025098-0 |