PPIRE17359
Target Protein Information
| Protein_Name | |
|---|---|
| Protein_Sequence | MRYLIATAVLVAVVLVGWPAAGAPPSCAGLGGTVQAGQICHVHASGPKYMLDMTFPVDYPDQQALTDYITQNRDGFVNVAQGSPLRDQPYQMDATSEQHSSGQPPQATRSVVLKFFQDLGGAHPSTWYKAFNYNLATSQPITFDTLFVPGTTPLDSIYPIVQRELARQTGFGAAILPSTGLDPAHYQNFAITDDSLIFYFAQGELLPSFVGACQAQVPRSAIPPLAI |
| Organism_Source | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Functional_Classification | |
| Cellular_Localization | Extracellular |
| Gene_Names | |
| UniProt_ID | O53283 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | M2C11 |
|---|---|
| Peptide_Sequence | VPRSAIDSMLA |
| Peptide_Length | 11 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)C(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1159.37 |
|---|---|
| Aliphatic_Index | 115.45455 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.27273 |
| Charge_at_pH_7 | -0.00157 |
| Isoelectric_Point | 6.33872 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 17 |
| Number_of_Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 485.19000 |
| X_logP_energy | -4.98383 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Selection and application of peptide mimotopes of MPT64 protein in Mycobacterium tuberculosis |
| Release_Year | 2011 |
| PMID | 20930053 |
| DOI | 10.1099/jmm.0.025098-0 |