PPIRE17362
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MAWVWTLLFLMAAAQSIQAQIQLVQSGPELKKPGETVKISCKASGYTFTDYSMHWVKQAPGKGLKWMGWVNIETGESVYADDFKGRFAFSLETSASTIHLQINNLKNEDTATYFCARSDYDYDIYAMDYWGQGTSVTVSSESARNPTIYPLTLPPALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGRYTMSSQLTLPAVECPEGESVKCSVQHDSNPVQELDVNCSGPTPPPPITIPSCQPSLSLQRPALEDLLLGSDASITCTLNGLRNPEGAVFTWEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESGTLTGTIAKVTVNTFPPQVHLLPPPSEELALNELLSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAETWKQGDQYSCMVGHEALPMNFTQKTIDRLSGKPTNVSVSVIMSEGDGICY |
| Organism_Source | Mus musculus |
| Functional_Classification | antibodies |
| Cellular_Localization | Extracellular |
| Gene_Names | Igh |
| UniProt_ID | Q99LA6 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PCS(424-436-Tyr-430NO2) |
|---|---|
| Peptide_Sequence | GKRLKNXSLPWGA |
| Peptide_Length | 13 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)CN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | X7=3-nitrotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1383.62 |
|---|---|
| Aliphatic_Index | 67.69231 |
| Aromaticity | 0.07692 |
| Average_Rotatable_Bonds | 3.46154 |
| Charge_at_pH_7 | 2.99739 |
| Isoelectric_Point | 11.82306 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 19 |
| Number_of_Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 596.78000 |
| X_logP_energy | -6.15863 |
Interaction Information
| Affinity | KD=60 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Epitope motif of an anti-nitrotyrosine antibody specific for tyrosine-nitrated peptides revealed by a combination of affinity approaches and mass spectrometry |
| Release_Year | 2011 |
| PMID | 21308874 |
| DOI | 10.1002/psc.1298 |