PPIRE17469
Target Protein Information
| Protein_Name | Ig gamma-2A chain C region A allele |
|---|---|
| Protein_Sequence | AKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | IgG |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg |
| UniProt_ID | P01863 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide 10 |
|---|---|
| Peptide_Sequence | CTASARGDLAHLTTTXC |
| Peptide_Length | 17 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CS)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CS)C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | X16=6-aminohexanoic acid |
| Cyclization_Method | Side chain-side chain cyclization; C1<-->C17; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1677.87 |
|---|---|
| Aliphatic_Index | 63.52941 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.05882 |
| Charge_at_pH_7 | -0.03461 |
| Isoelectric_Point | 7.25386 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 28 |
| Number_of_Hydrogen_Bond_Donors | 30 |
| Topological_Polar_Surface_Area | 757.95000 |
| X_logP_energy | -12.35133 |
Interaction Information
| Affinity | KD=8.33 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Native-like cyclic peptide models of a viral antigenic site: finding a balance between rigidity and flexibility |
| Release_Year | 2000 |
| PMID | 10679891 |
| DOI | 10.1002/(SICI)1099-1352(200001/02)13:1<5::AID-JMR480>3.0.CO;2-L |