PPIRE17493
Target Protein Information
| Protein_Name | 14-3-3 protein sigma |
|---|---|
| Protein_Sequence | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
| Organism_Source | Homo sapiens |
| Functional_Classification | adapter proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SFN |
| UniProt_ID | P31947 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p53 CTD 32mer peptide |
|---|---|
| Peptide_Sequence | SRAHSSHLKSKKGQSTSRHKKLMFKXEGPDSD |
| Peptide_Length | 32 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CO)[C@@H](C)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | X26=phosphothreonine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3552.97 |
|---|---|
| Aliphatic_Index | 27.50000 |
| Aromaticity | 0.03125 |
| Average_Rotatable_Bonds | 3.96875 |
| Charge_at_pH_7 | 5.27160 |
| Isoelectric_Point | 11.07854 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 57 |
| Number_of_Hydrogen_Bond_Donors | 59 |
| Topological_Polar_Surface_Area | 1639.42000 |
| X_logP_energy | -23.46006 |
Interaction Information
| Affinity | KD=13.6 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Adoption of a Turn Conformation Drives the Binding Affinity of p53 C-Terminal Domain Peptides to 14-3-3M |
| Release_Year | 2019 |
| PMID | 31742997 |
| DOI | 10.1021/acschembio.9b00893 |