PPIRE17618
Target Protein Information
| Protein_Name | Matrix protein |
|---|---|
| Protein_Sequence | MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTYDPNQLRYEKFFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHTHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWVLDSISHFK |
| Organism_Source | Vesicular stomatitis Indiana virus (strain San Juan) |
| Functional_Classification | Viral matrix proteins matrix protein |
| Cellular_Localization | Nucleus |
| Gene_Names | M |
| UniProt_ID | P03519 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | R44CPNA |
|---|---|
| Peptide_Sequence | RTRQARRNRRXRWRERQR |
| Peptide_Length | 18 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | X11=cytosine PNA monomer |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | succinyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2494.82 |
|---|---|
| Aliphatic_Index | 5.55556 |
| Aromaticity | 0.05556 |
| Average_Rotatable_Bonds | 4.94444 |
| Charge_at_pH_7 | 8.99973 |
| Isoelectric_Point | 13.10207 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 34 |
| Number_of_Hydrogen_Bond_Donors | 55 |
| Topological_Polar_Surface_Area | 1379.61000 |
| X_logP_energy | -18.70010 |
Interaction Information
| Affinity | KD=240 nM |
|---|---|
| Affinity_Assay | fluorescence anisotropy |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Construction of HIV Rev Peptides Containing Peptide Nucleic Acid That Bind HIV RRE IIB RNA |
| Release_Year | 2000 |
| PMID | 10714504 |
| DOI | 10.1016/S0960-894X(00)00006-8 |