PPIRE17965
Target Protein Information
| Protein_Name | Protein Tat |
|---|---|
| Protein_Sequence | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE |
| Organism_Source | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) |
| Functional_Classification | Transcriptional activators viral transactivators |
| Cellular_Localization | Nucleus |
| Gene_Names | tat |
| UniProt_ID | P04608 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide 1 |
|---|---|
| Peptide_Sequence | CLDILVPRQRTPRGQAFVIC |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)CC)C(C)C)[C@@H](C)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | Side chain cyclization; C1<-->C20; other bonds |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2285.75 |
|---|---|
| Aliphatic_Index | 112.00000 |
| Aromaticity | 0.05000 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | 1.87447 |
| Isoelectric_Point | 8.83478 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 30 |
| Number_of_Hydrogen_Bond_Donors | 34 |
| Topological_Polar_Surface_Area | 928.05000 |
| X_logP_energy | -7.95179 |
Interaction Information
| Affinity | KD=1.8 uM |
|---|---|
| Affinity_Assay | fluorescence emission |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of HIV TAR in complex with a Lab-Evolved RRM provides insight into duplex RNA recognition and synthesis of a constrained peptide that impairs transcription |
| Release_Year | 2018 |
| PMID | 29961805 |
| DOI | 10.1093/nar/gky529 |