PPIRE17984
Target Protein Information
| Protein_Name | Putative uncharacterized protein ATP1A1-AS1 |
|---|---|
| Protein_Sequence | MAHFKDDLQTNVEIIPGESAPRKESPRPPAPPSSAAGVGGCSNHSPSVQESPLSPPALAQLGSAQQPSMRTELSFSEKKDTMIIWQITITVWCQR |
| Organism_Source | Homo sapiens |
| Functional_Classification | P type ATPases |
| Cellular_Localization | Plasma membrane |
| Gene_Names | ATP1A1-AS1 |
| UniProt_ID | Q5TC04 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | NaK ATPase P1 |
|---|---|
| Peptide_Sequence | CIPFNSTNK |
| Peptide_Length | 9 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)CS)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1023.17 |
|---|---|
| Aliphatic_Index | 43.33333 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.44444 |
| Charge_at_pH_7 | 0.93571 |
| Isoelectric_Point | 8.54519 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 439.99000 |
| X_logP_energy | -5.74560 |
Interaction Information
| Affinity | KD=0.19 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Competition between bound and free peptides in an ELISA-based procedure that assays peptides derived from protein digests |
| Release_Year | 2006 |
| PMID | 16737525 |
| DOI | 10.1186/1477-5956-4-12 |