PPIRE18065
Target Protein Information
| Protein_Name | Immunoglobulin heavy constant gamma 1 |
|---|---|
| Protein_Sequence | ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA |
| Organism_Source | Homo sapiens |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | IGHG1 |
| UniProt_ID | P01857 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | cQFD meditope |
|---|---|
| Peptide_Sequence | CQFDLSTRRLKC |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CS)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | side chain-side chain cyclization; C1<-->C12; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1469.74 |
|---|---|
| Aliphatic_Index | 65.00000 |
| Aromaticity | 0.08333 |
| Average_Rotatable_Bonds | 4.16667 |
| Charge_at_pH_7 | 1.87418 |
| Isoelectric_Point | 8.82805 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 22 |
| Number_of_Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 654.09000 |
| X_logP_energy | -7.30556 |
Interaction Information
| Affinity | KD=430 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | 4GW1 |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies |
| Release_Year | 2013 |
| PMID | 24101516 |
| DOI | 10.1073/pnas.1307309110 |