PPIRE18128
Target Protein Information
| Protein_Name | Platelet glycoprotein VI |
|---|---|
| Protein_Sequence | MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS |
| Organism_Source | Homo sapiens |
| Functional_Classification | immunoglobulin receptors |
| Cellular_Localization | Plasma membrane |
| Gene_Names | GP6 |
| UniProt_ID | Q9HCN6 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pep-10L |
|---|---|
| Peptide_Sequence | YSDTDWLYFSTS |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)Cc1ccc(O)cc1)[C@@H](C)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1484.54 |
|---|---|
| Aliphatic_Index | 32.50000 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | -2.00282 |
| Isoelectric_Point | 3.49188 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 22 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 615.42000 |
| X_logP_energy | -5.67160 |
Interaction Information
| Affinity | KD=57 uM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure-Based Approach To Improve a Small-Molecule Inhibitor by the Use of a Competitive Peptide Ligand |
| Release_Year | 2014 |
| PMID | 24481871 |
| DOI | 10.1002/anie.201310749 |