PPIRE18129
Target Protein Information
| Protein_Name | Protein Tat |
|---|---|
| Protein_Sequence | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE |
| Organism_Source | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) |
| Functional_Classification | viral regulatory |
| Cellular_Localization | Nucleus |
| Gene_Names | tat |
| UniProt_ID | P04608 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | L-22 |
|---|---|
| Peptide_Sequence | RVRRVCRTQKGRCRIRI |
| Peptide_Length | 17 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CS)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCNC(=N)N)C(C)C)C(C)C)[C@@H](C)O)[C@@H](C)CC)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2156.65 |
|---|---|
| Aliphatic_Index | 80.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.52941 |
| Charge_at_pH_7 | 7.87372 |
| Isoelectric_Point | 12.62871 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 30 |
| Number_of_Hydrogen_Bond_Donors | 44 |
| Topological_Polar_Surface_Area | 1051.56000 |
| X_logP_energy | -12.33151 |
Interaction Information
| Affinity | KD=30 nM |
|---|---|
| Affinity_Assay | electrophoretic mobility shift assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Essential structural requirements for specific recognition of HIV TAR RNA by peptide mimetics of Tat protein |
| Release_Year | 2011 |
| PMID | 20724442 |
| DOI | 10.1093/nar/gkq713 |