PPIRE18136
Target Protein Information
| Protein_Name | Phosphatidylethanolamine-binding protein 1 |
|---|---|
| Protein_Sequence | MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK |
| Organism_Source | Homo sapiens |
| Functional_Classification | kinase inhibitors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PEBP1 |
| UniProt_ID | P30086 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Raf-1 peptide (tri-phosphorylated) |
|---|---|
| Peptide_Sequence | RPRGQRDSSYYWEIEASEV |
| Peptide_Length | 19 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)O)C(C)C |
| Chemical_Modification | S8=phosphoserine; S9=phosphoserine; Y11=phosphotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2328.48 |
|---|---|
| Aliphatic_Index | 41.05263 |
| Aromaticity | 0.15789 |
| Average_Rotatable_Bonds | 3.89474 |
| Charge_at_pH_7 | -0.99795 |
| Isoelectric_Point | 4.58762 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 33 |
| Number_of_Hydrogen_Bond_Donors | 39 |
| Topological_Polar_Surface_Area | 1073.26000 |
| X_logP_energy | -11.29379 |
Interaction Information
| Affinity | KD=116 uM |
|---|---|
| Affinity_Assay | native mass spectrometry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Ligand Binding Study of Human PEBP1/RKIP: Interaction with Nucleotides and Raf-1 Peptides Evidenced by NMR and Mass Spectrometry |
| Release_Year | 2012 |
| PMID | 22558375 |
| DOI | 10.1371/journal.pone.0036187 |