PPIRE18176
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MGLFLPLEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
| Organism_Source | Gallus gallus |
| Functional_Classification | EF hand calcium binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | CALM1 |
| UniProt_ID | A0A8V0YVM4 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Melittin |
|---|---|
| Peptide_Sequence | GIGAVLKVLTTGLPALISWIKRKRQQ |
| Peptide_Length | 26 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)O)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)[C@@H](C)O)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2847.49 |
|---|---|
| Aliphatic_Index | 135.00000 |
| Aromaticity | 0.03846 |
| Average_Rotatable_Bonds | 3.73077 |
| Charge_at_pH_7 | 4.99709 |
| Isoelectric_Point | 12.54608 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 37 |
| Number_of_Hydrogen_Bond_Donors | 41 |
| Topological_Polar_Surface_Area | 1146.55000 |
| X_logP_energy | -8.48436 |
Interaction Information
| Affinity | KD=35 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Over-expression of antimicrobial anticancer and transmembrane peptides in Escherichia coli through a calmodulin-peptide fusion system |
| Release_Year | 2016 |
| PMID | 27502305 |
| DOI | 10.1021/jacs.6b06781 |