PPIRE18178
Target Protein Information
| Protein_Name | |
|---|---|
| Protein_Sequence | MGLFLPLEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
| Organism_Source | Gallus gallus |
| Functional_Classification | EF hand calcium binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | CALM1 |
| UniProt_ID | A0A8V0YVM4 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Puroindoline A peptide |
|---|---|
| Peptide_Sequence | FPVTWKWWKWWKG |
| Peptide_Length | 13 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)O)[C@@H](C)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1835.19 |
|---|---|
| Aliphatic_Index | 22.30769 |
| Aromaticity | 0.46154 |
| Average_Rotatable_Bonds | 3.84615 |
| Charge_at_pH_7 | 2.99710 |
| Isoelectric_Point | 11.10307 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 18 |
| Number_of_Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 580.97000 |
| X_logP_energy | 3.64000 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Over-expression of antimicrobial anticancer and transmembrane peptides in Escherichia coli through a calmodulin-peptide fusion system |
| Release_Year | 2016 |
| PMID | 27502305 |
| DOI | 10.1021/jacs.6b06781 |