PPIRE18310
Target Protein Information
| Protein_Name | H-2 class II histocompatibility antigen A-F alpha chain |
|---|---|
| Protein_Sequence | EDDIEADHVGFYGISVYQSPGDIGQYTFEFDGDEWFYVDLDKKETVWRLPEFGQLTSFDPQGGLQEIATGKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFIIQGLRSGGTSRHPGPL |
| Organism_Source | Mus musculus |
| Functional_Classification | MHC class 2 |
| Cellular_Localization | Plasma membrane |
| Gene_Names | H2-Aa |
| UniProt_ID | P14435 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CII (442-457) G451A analogue |
|---|---|
| Peptide_Sequence | GPXGPAGPAAARGEQG |
| Peptide_Length | 16 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)CNC(=O)[C@@H]1CCCN1C(=O)CN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)O |
| Chemical_Modification | X3=hydroxyproline |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1349.43 |
|---|---|
| Aliphatic_Index | 25.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.37500 |
| Charge_at_pH_7 | -0.00024 |
| Isoelectric_Point | 6.41015 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 20 |
| Number_of_Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 615.74000 |
| X_logP_energy | -10.54953 |
Interaction Information
| Affinity | IC50=10000 uM |
|---|---|
| Affinity_Assay | Competition binding assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Molecular characterization of an arthritogenic collagen peptide interacting with I-Ar |
| Release_Year | 2005 |
| PMID | 16423049 |
| DOI | 10.1111/j.1365-2567.2005.02278.x |