PPIRE18448
Target Protein Information
| Protein_Name | Tumor necrosis factor |
|---|---|
| Protein_Sequence | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Organism_Source | Homo sapiens |
| Functional_Classification | tumor necrosis factor family |
| Cellular_Localization | Extracellular |
| Gene_Names | TNF |
| UniProt_ID | P01375 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | G6 |
|---|---|
| Peptide_Sequence | SSYYPQWPTDRF |
| Peptide_Length | 12 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1546.66 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 3.41667 |
| Charge_at_pH_7 | -0.00327 |
| Isoelectric_Point | 6.32528 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 625.07000 |
| X_logP_energy | -5.02433 |
Interaction Information
| Affinity | KD=19.97 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Integration of binding peptide selection and multifunctional particles as tool-box for capture of soluble proteins in serum |
| Release_Year | 2014 |
| PMID | 25100324 |
| DOI | 10.1098/rsif.2014.0718 |