PPIRE18501
Target Protein Information
| Protein_Name | Streptavidin |
|---|---|
| Protein_Sequence | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Organism_Source | Streptomyces avidinii |
| Functional_Classification | none |
| Cellular_Localization | Extracellular |
| Gene_Names | |
| UniProt_ID | P22629 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Strep-tag |
|---|---|
| Peptide_Sequence | SAWRHPQFGG |
| Peptide_Length | 10 |
| Peptide_SMILES | C[C@H](NC(=O)[C@@H](N)CO)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1142.24 |
|---|---|
| Aliphatic_Index | 10.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.20000 |
| Charge_at_pH_7 | 1.08889 |
| Isoelectric_Point | 10.55176 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 486.12000 |
| X_logP_energy | -4.99603 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A recombinant scFv/streptavidin-binding peptide fusion protein for the quantitative determination of the scorpion venom neurotoxin AahI |
| Release_Year | 2001 |
| PMID | 11767952 |
| DOI | 10.1515/BC.2001.197 |