PPIRE18518
Target Protein Information
| Protein_Name | Activated RNA polymerase II transcriptional coactivator p15 |
|---|---|
| Protein_Sequence | MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL |
| Organism_Source | Homo sapiens |
| Functional_Classification | Transcriptional coactivators |
| Cellular_Localization | Nucleus |
| Gene_Names | SUB1 |
| UniProt_ID | P53999 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p53-(380-386-K381KAc/K382KAc/K386KAc) |
|---|---|
| Peptide_Sequence | XXXXXXX |
| Peptide_Length | 7 |
| Peptide_SMILES | NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | K2=acetyllysine; K3=acetyllysine; K7=acetyllysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 417.38 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 1.85714 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 8 |
| Number_of_Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 237.92000 |
| X_logP_energy | -6.27310 |
Interaction Information
| Affinity | KD=0.35 nM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptide-Protein Interactions Suggest That Acetylation of Lysines 381 and 382 of p53 Is Important for Positive Coactivator 4-p53 Interaction |
| Release_Year | 2011 |
| PMID | 21586571 |
| DOI | 10.1074/jbc.M110.205328 |