PPIRE18562
Target Protein Information
| Protein_Name | Protein Tat |
|---|---|
| Protein_Sequence | MPGPWVAMIMLPQPKESFGGKPIGWLFWNTCKGPRRDCPHCCCPICSWHCQLCFLQKNLGINYGSGPRRRGTRGKGRRIRRTASGGDQRREADSQRSFTNMDQ |
| Organism_Source | Bovine immunodeficiency virus (strain R29) |
| Functional_Classification | viral RNA regulatory element |
| Cellular_Localization | Nucleus |
| Gene_Names | tat |
| UniProt_ID | P19564 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | cyclic BIV Tat peptide |
|---|---|
| Peptide_Sequence | yGRGTRGKGRRIVN |
| Peptide_Length | 14 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)[C@@H](C)O)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)O)C(C)C |
| Chemical_Modification | y1=D-tyrosine |
| Cyclization_Method | Main chain-main chain cyclization; y1<-->N14; amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | none |
| C-terminal_Modification | none |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1589.82 |
|---|---|
| Aliphatic_Index | 48.57143 |
| Aromaticity | 0.07143 |
| Average_Rotatable_Bonds | 3.92857 |
| Charge_at_pH_7 | 4.99683 |
| Isoelectric_Point | 12.51004 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 31 |
| Topological_Polar_Surface_Area | 798.79000 |
| X_logP_energy | -10.68502 |
Interaction Information
| Affinity | KD=1 uM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design of a Cyclic Peptide that Targets a Viral RNA |
| Release_Year | 2003 |
| PMID | 14677935 |
| DOI | 10.1021/ja036344h |