PPIRE18695
Target Protein Information
| Protein_Name | Alpha-hemolysin |
|---|---|
| Protein_Sequence | MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN |
| Organism_Source | Staphylococcus aureus |
| Functional_Classification | pore forming toxins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | hly |
| UniProt_ID | P09616 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CAMA |
|---|---|
| Peptide_Sequence | KWKLFKKIGIGKFLHSAKKF |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCCCN)[C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2405.02 |
|---|---|
| Aliphatic_Index | 83.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 4.30000 |
| Charge_at_pH_7 | 7.08683 |
| Isoelectric_Point | 11.57869 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 30 |
| Number_of_Hydrogen_Bond_Donors | 31 |
| Topological_Polar_Surface_Area | 863.06000 |
| X_logP_energy | -1.61020 |
Interaction Information
| Affinity | KD=6.3 uM |
|---|---|
| Affinity_Assay | fluorescence spectroscopy |
| PDB_ID | None |
| Type | Ion channel modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Protein Nanopore-Based Single-Molecule Exploration of Copper Binding to an Antimicrobial-Derived Histidine-Containing Chimera Peptide |
| Release_Year | 2012 |
| PMID | 23140333 |
| DOI | 10.1021/la303782d |