PPIRE18698
Target Protein Information
| Protein_Name | Envelope small membrane protein |
|---|---|
| Protein_Sequence | MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV |
| Organism_Source | Severe acute respiratory syndrome coronavirus |
| Functional_Classification | viroporins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | E |
| UniProt_ID | P59637 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | TK9 |
|---|---|
| Peptide_Sequence | TVYVYSRVK |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)[C@@H](N)[C@@H](C)O)C(C)C)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1114.31 |
|---|---|
| Aliphatic_Index | 96.66667 |
| Aromaticity | 0.22222 |
| Average_Rotatable_Bonds | 3.77778 |
| Charge_at_pH_7 | 1.99599 |
| Isoelectric_Point | 10.00862 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 464.96000 |
| X_logP_energy | -3.09333 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural insights of a self-assembling 9-residue peptide from the C-terminal tail of the SARS corona virus E-protein in DPC and SDS micelles: A combined high and low resolution spectroscopic study |
| Release_Year | 2017 |
| PMID | 29038024 |
| DOI | 10.1016/j.bbamem.2017.10.015 |