PPIRE18700
Target Protein Information
| Protein_Name | Tumor necrosis factor ligand superfamily member 6 |
|---|---|
| Protein_Sequence | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
| Organism_Source | Homo sapiens |
| Functional_Classification | tumor necrosis factor ligands |
| Cellular_Localization | Extracellular |
| Gene_Names | FASLG |
| UniProt_ID | P48023 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide 5 |
|---|---|
| Peptide_Sequence | SAQPFRLLTA |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | homoserine lactone |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1103.29 |
|---|---|
| Aliphatic_Index | 98.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.30000 |
| Charge_at_pH_7 | 0.99798 |
| Isoelectric_Point | 10.55000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 461.88000 |
| X_logP_energy | -4.45573 |
Interaction Information
| Affinity | KD=4000 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Rapid preparation of stable isotope labeled peptides that bind to target proteins by a phage library system |
| Release_Year | 2006 |
| PMID | 16505961 |
| DOI | 10.1007/s10858-005-5054-0 |