PPIRE18708
Target Protein Information
| Protein_Name | BTB/POZ domain-containing protein KCTD11 |
|---|---|
| Protein_Sequence | MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligase adaptors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | KCTD11 |
| UniProt_ID | Q693B1 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Cul3wt pep |
|---|---|
| Peptide_Sequence | NSGLSFEELYRNAYTMVLHK |
| Peptide_Length | 20 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)[C@@H](C)O)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | biotinylation |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2372.68 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.15000 |
| Average_Rotatable_Bonds | 3.90000 |
| Charge_at_pH_7 | 0.09044 |
| Isoelectric_Point | 7.53516 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 34 |
| Number_of_Hydrogen_Bond_Donors | 35 |
| Topological_Polar_Surface_Area | 994.75000 |
| X_logP_energy | -8.84863 |
Interaction Information
| Affinity | KD=0.8 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design synthesis and characterization of a peptide able to bind proteins of the KCTD family: implications for KCTD - cullin 3 recognition |
| Release_Year | 2011 |
| PMID | 21438081 |
| DOI | 10.1002/psc.1366 |