PPIRE18712
Target Protein Information
| Protein_Name | Troponin C skeletal muscle |
|---|---|
| Protein_Sequence | MASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGVQ |
| Organism_Source | Gallus gallus |
| Functional_Classification | calcium binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TNNC2 |
| UniProt_ID | P02588 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | LII |
|---|---|
| Peptide_Sequence | KSEEELANAFRIFEGEFDYIWEEDKVIIPIEEDLGELRATG |
| Peptide_Length | 41 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)NCC(=O)O)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)CC)C(C)C)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 4802.28 |
|---|---|
| Aliphatic_Index | 90.48780 |
| Aromaticity | 0.12195 |
| Average_Rotatable_Bonds | 3.97561 |
| Charge_at_pH_7 | -8.98437 |
| Isoelectric_Point | 3.76161 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 63 |
| Number_of_Hydrogen_Bond_Donors | 67 |
| Topological_Polar_Surface_Area | 1998.84000 |
| X_logP_energy | -13.21926 |
Interaction Information
| Affinity | KD=3 mM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Probing the Relationship between Alpha-Helix Formation and Calcium Affinity in Troponin C: 1H NMR Studies of Calcium Binding to Synthetic and Variant Site III Helix-Loop-Helix Peptides |
| Release_Year | 1991 |
| PMID | 2001358 |
| DOI | 10.1021/bi00224a019 |