PPIRE18716
Target Protein Information
| Protein_Name | Ig gamma-2A chain C region A allele |
|---|---|
| Protein_Sequence | AKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulin G |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg |
| UniProt_ID | P01863 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HPWEDRQSAFL |
|---|---|
| Peptide_Sequence | HPWEDRQSAFL |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)Cc1c[nH]cn1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1385.50 |
|---|---|
| Aliphatic_Index | 44.54545 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 3.72727 |
| Charge_at_pH_7 | -0.90889 |
| Isoelectric_Point | 5.45431 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 18 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 589.82000 |
| X_logP_energy | -4.38843 |
Interaction Information
| Affinity | IC50=28 nM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Analyte Peptidomimetics Selected from Phage Display Peptide Libraries: A Systematic Strategy for the Development of Environmental Immunoassays |
| Release_Year | 2005 |
| PMID | 15984805 |
| DOI | 10.1021/es047931l |