PPIRE18806
Target Protein Information
| Protein_Name | Gamma-aminobutyric acid receptor-associated protein |
|---|---|
| Protein_Sequence | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
| Organism_Source | Homo sapiens |
| Functional_Classification | microtubule associated proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GABARAP |
| UniProt_ID | O95166 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | tubulin alpha C-terminal tail peptide (432-445) |
|---|---|
| Peptide_Sequence | EQGEFEEEGEEDEA |
| Peptide_Length | 14 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1626.52 |
|---|---|
| Aliphatic_Index | 7.14286 |
| Aromaticity | 0.07143 |
| Average_Rotatable_Bonds | 4.14286 |
| Charge_at_pH_7 | -8.98737 |
| Isoelectric_Point | 3.05084 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 25 |
| Number_of_Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 820.41000 |
| X_logP_energy | -9.11530 |
Interaction Information
| Affinity | KD=0.2 mM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | 1GNU |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The X-ray Crystal Structure and Putative Ligand-derived Peptide Binding Properties of Gamma-Aminobutyric Acid Receptor Type A Receptor-associated Protein |
| Release_Year | 2002 |
| PMID | 11729197 |
| DOI | 10.1074/jbc.M109753200 |