PPIRE18808
Target Protein Information
| Protein_Name | Serine protease 1 |
|---|---|
| Protein_Sequence | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN |
| Organism_Source | Bos taurus |
| Functional_Classification | serine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | PRSS1 |
| UniProt_ID | P00760 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PA |
|---|---|
| Peptide_Sequence | CSSIYQKPAPTSC |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C1<-->C13; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1384.58 |
|---|---|
| Aliphatic_Index | 37.69231 |
| Aromaticity | 0.07692 |
| Average_Rotatable_Bonds | 3.07692 |
| Charge_at_pH_7 | 0.87289 |
| Isoelectric_Point | 8.22117 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 565.20000 |
| X_logP_energy | -8.14560 |
Interaction Information
| Affinity | KD=167 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A Conserved cis Peptide Bond Is Necessary for the Activity of Bowman-Birk Inhibitor Protein |
| Release_Year | 2002 |
| PMID | 12186545 |
| DOI | 10.1021/bi026050t |