PPIRE18812
Target Protein Information
| Protein_Name | Uncharacterized protein encoded by SND1-IT1 |
|---|---|
| Protein_Sequence | MSHHPHSLRNSCLIRMDLLYWQFTIYTITFCFSHLSGRLTLSAQHISHRPCLLSYSLLFWKVHHLFLEGFPCSPRLDEMSFHQFPQHPVHVSVVHLPIVYKGSMTQVSPH |
| Organism_Source | Homo sapiens |
| Functional_Classification | endonucleases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SND1-IT1 |
| UniProt_ID | Q9HBX3 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 45749 |
|---|---|
| Peptide_Sequence | QFDYDHFLMWYS |
| Peptide_Length | 12 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CCC(N)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1651.81 |
|---|---|
| Aliphatic_Index | 32.50000 |
| Aromaticity | 0.41667 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | -1.91191 |
| Isoelectric_Point | 4.10657 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 606.27000 |
| X_logP_energy | -1.19070 |
Interaction Information
| Affinity | EC50=52.1 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Disruption of SND1-MTDH interaction by a high affinity peptide results in SND1 degradation and cytotoxicity to breast cancer cells in vitro and in vivo |
| Release_Year | 2020 |
| PMID | 33268570 |
| DOI | 10.1158/1535-7163.MCT-20-0130 |