PPIRE18862
Target Protein Information
| Protein_Name | Neuropeptide Y receptor type 1 |
|---|---|
| Protein_Sequence | MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | NPY1R |
| UniProt_ID | P25929 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 5c |
|---|---|
| Peptide_Sequence | XPXXPX |
| Peptide_Length | 6 |
| Peptide_SMILES | NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)O |
| Chemical_Modification | X1=b2hTyr; X?=pseudoproline blocks |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 440.46 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 1.50000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 7 |
| Number_of_Hydrogen_Bond_Donors | 5 |
| Topological_Polar_Surface_Area | 191.24000 |
| X_logP_energy | -3.63970 |
Interaction Information
| Affinity | IC50=2.4 nM |
|---|---|
| Affinity_Assay | receptor autoradiography ([125I]PYY on SK-N-MC cell membranes) |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | On the terminal homologation of physiologically active peptides as a means of increasing stability in human serum--neurotensin opiorphin B27-KK10 epitope NPY |
| Release_Year | 2011 |
| PMID | 21560227 |
| DOI | 10.1002/cbdv.201100093 |