PPIRE18911
Target Protein Information
| Protein_Name | Melanocortin receptor 3 |
|---|---|
| Protein_Sequence | MNSSCCLSSVSPMLPNLSEHPAAPPASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVILAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIAVINSDSLTLEDQFIQHMDNIFDSMICISLVASICNLLAIAIDRYVTIFYALRYHSIMTVRKALTLIGVIWVCCGICGVMFIIYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAVLPPAGVVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFKEILCGCNSMNLG |
| Organism_Source | Mus musculus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Mc3r |
| UniProt_ID | P33033 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | NDP-MSH |
|---|---|
| Peptide_Sequence | SYSXEHfRWGKPV |
| Peptide_Length | 13 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CO)C(=O)O |
| Chemical_Modification | X4=norleucine; f4=D-phenylalanine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1549.71 |
|---|---|
| Aliphatic_Index | 22.30769 |
| Aromaticity | 0.23077 |
| Average_Rotatable_Bonds | 3.53846 |
| Charge_at_pH_7 | 1.08952 |
| Isoelectric_Point | 9.29976 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 634.11000 |
| X_logP_energy | -5.23663 |
Interaction Information
| Affinity | EC50=0.35 nM |
|---|---|
| Affinity_Assay | cAMP-based Beta-galactosidase reporter gene assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis Biophysical and Pharmacological Evaluation of the Melanocortin Agonist AST3-88: Modifications of Peptide Backbone at Trp 7 Position Lead to a Potent Selective and Stable Ligand of the Melanocortin 4 Receptor (MC4R) |
| Release_Year | 2014 |
| PMID | 25141170 |
| DOI | 10.1021/cn5000953 |