PPIRE18916
Target Protein Information
| Protein_Name | Melanocortin receptor 4 |
|---|---|
| Protein_Sequence | MNSTHHHGMYTSLHLWNRSSYGLHGNASESLGKGHPDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVSGVLFIIYSDSSAVIICLISMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGTNMKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPLIYALRSQELRKTFKEIICFYPLGGICELSSRY |
| Organism_Source | Mus musculus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Mc4r |
| UniProt_ID | P56450 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | AMW3-130 |
|---|---|
| Peptide_Sequence | YCHfRWNAFCY |
| Peptide_Length | 11 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CS)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | side chain-side chain cyclization; C2<-->C10; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1509.72 |
|---|---|
| Aliphatic_Index | 9.09091 |
| Aromaticity | 0.45455 |
| Average_Rotatable_Bonds | 3.72727 |
| Charge_at_pH_7 | 0.96324 |
| Isoelectric_Point | 8.22620 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 19 |
| Number_of_Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 544.24000 |
| X_logP_energy | -1.66373 |
Interaction Information
| Affinity | EC50=7600 nM |
|---|---|
| Affinity_Assay | cAMP-based Beta-galactosidase reporter gene assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis Biophysical and Pharmacological Evaluation of the Melanocortin Agonist AST3-88: Modifications of Peptide Backbone at Trp 7 Position Lead to a Potent Selective and Stable Ligand of the Melanocortin 4 Receptor (MC4R) |
| Release_Year | 2014 |
| PMID | 25141170 |
| DOI | 10.1021/cn5000953 |