PPIRE18927
Target Protein Information
| Protein_Name | Prolactin-releasing peptide receptor |
|---|---|
| Protein_Sequence | MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | PRLHR |
| UniProt_ID | P49683 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | analog 3 |
|---|---|
| Peptide_Sequence | SRTHRHSMEIKTPDINPAWYASRGIRPVGRF |
| Peptide_Length | 31 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CO)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)O)C(C)C |
| Chemical_Modification | N1=TTDS palmitoyl;K11=TTDS palmitoyl |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | palmitoylation |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3637.14 |
|---|---|
| Aliphatic_Index | 53.54839 |
| Aromaticity | 0.09677 |
| Average_Rotatable_Bonds | 3.67742 |
| Charge_at_pH_7 | 4.18086 |
| Isoelectric_Point | 11.94119 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 50 |
| Number_of_Hydrogen_Bond_Donors | 57 |
| Topological_Polar_Surface_Area | 1557.69000 |
| X_logP_energy | -16.44375 |
Interaction Information
| Affinity | Ki=32.4 nM |
|---|---|
| Affinity_Assay | Radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Impact of novel palmitoylated prolactin releasing peptide analogs on metabolic changes in mice with diet induced obesity |
| Release_Year | 2017 |
| PMID | 28820912 |
| DOI | 10.1371/journal.pone.0183449 |